IGFBP6 (NM_002178) Human Mass Spec Standard
CAT#: PH304060
IGFBP6 MS Standard C13 and N15-labeled recombinant protein (NP_002169)
View other "IGFBP6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IGFBP6 MS Standard C13 and N15-labeled recombinant protein (NP_002169) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204060 |
| Predicted MW | 25.3 kDa |
| Protein Sequence |
>RC204060 protein sequence
Red=Cloning site Green=Tags(s) MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQE CGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRN PGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRG PCWCVDRMGKSLPGSPDGNGSSSCPTGSSG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002169 |
| RefSeq Size | 980 |
| RefSeq ORF | 720 |
| Synonyms | IBP6 |
| Locus ID | 3489 |
| Cytogenetics | 12q13.13 |
| Summary | IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400790 | IGFBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400790 | Transient overexpression lysate of insulin-like growth factor binding protein 6 (IGFBP6) |
CNY 3080.00 |
|
| TP304060 | Recombinant protein of human insulin-like growth factor binding protein 6 (IGFBP6), 20 µg |
CNY 2900.00 |

