CD99 (NM_002414) Human Mass Spec Standard
CAT#: PH304056
CD99 MS Standard C13 and N15-labeled recombinant protein (NP_002405)
View other "CD99" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CD99 MS Standard C13 and N15-labeled recombinant protein (NP_002405) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204056 |
| Predicted MW | 18.8 kDa |
| Protein Sequence |
>RC204056 protein sequence
Red=Cloning site Green=Tags(s) MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002405 |
| RefSeq Size | 1255 |
| RefSeq ORF | 555 |
| Synonyms | HBA71; MIC2; MIC2X; MIC2Y; MSK5X |
| Locus ID | 4267 |
| Cytogenetics | X;Y |
| Summary | The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400863 | CD99 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426583 | CD99 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400863 | Transient overexpression lysate of CD99 molecule (CD99), transcript variant 1 |
CNY 3080.00 |
|
| LY426583 | Transient overexpression lysate of CD99 molecule (CD99), transcript variant 2 |
CNY 3080.00 |
|
| TP304056 | Purified recombinant protein of Homo sapiens CD99 molecule (CD99), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720374 | Recombinant protein of human CD99 molecule (CD99), transcript variant 2 |
CNY 3140.00 |


