14-3-3 sigma (SFN) (NM_006142) Human Mass Spec Standard
CAT#: PH304045
SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133)
View other "14-3-3 sigma" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204045 |
| Predicted MW | 27.8 kDa |
| Protein Sequence |
>RC204045 protein sequence
Red=Cloning site Green=Tags(s) MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006133 |
| RefSeq Size | 1336 |
| RefSeq ORF | 744 |
| Synonyms | YWHAS |
| Locus ID | 2810 |
| Cytogenetics | 1p36.11 |
| Summary | This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cell cycle, p53 signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401850 | SFN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401850 | Transient overexpression lysate of stratifin (SFN) |
CNY 3080.00 |
|
| TP304045 | Recombinant protein of human stratifin (SFN), 20 µg |
CNY 2900.00 |
|
| TP720151 | Recombinant protein of human stratifin (SFN) |
CNY 1800.00 |
其它14-3-3 sigma产品
