MED8 (NM_201542) Human Mass Spec Standard
CAT#: PH304026
MED8 MS Standard C13 and N15-labeled recombinant protein (NP_963836)
View other "MED8" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MED8 MS Standard C13 and N15-labeled recombinant protein (NP_963836) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204026 |
Predicted MW | 19 kDa |
Protein Sequence |
>RC204026 protein sequence
Red=Cloning site Green=Tags(s) MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEER ESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAP SQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_963836 |
RefSeq Size | 1989 |
RefSeq ORF | 537 |
Synonyms | ARC32 |
Locus ID | 112950 |
Cytogenetics | 1p34.2 |
Summary | This gene encodes a protein component of the mediator complex, which aids in transcriptional activation through interaction with RNA polymerase II and gene-specific transcription factors. The encoded protein may also function in ubiquitin ligation and protein degradation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404449 | MED8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409420 | MED8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424404 | MED8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404449 | Transient overexpression lysate of mediator complex subunit 8 (MED8), transcript variant 1 |
CNY 3080.00 |
|
LY409420 | Transient overexpression lysate of mediator complex subunit 8 (MED8), transcript variant 3 |
CNY 3080.00 |
|
LY424404 | Transient overexpression lysate of mediator complex subunit 8 (MED8), transcript variant 5 |
CNY 3080.00 |
|
TP304026 | Recombinant protein of human mediator complex subunit 8 (MED8), transcript variant 1, 20 µg |
CNY 2900.00 |