Tropomyosin 2 (TPM2) (NM_213674) Human Mass Spec Standard
CAT#: PH304007
TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_998839)
View other "Tropomyosin 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_998839) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204007 |
Predicted MW | 33 kDa |
Protein Sequence |
>RC204007 protein sequence
Red=Cloning site Green=Tags(s) MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEEELRTMDQALKSLMAS EEEYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEIHQTLDQTLLE LNNL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_998839 |
RefSeq Size | 1182 |
RefSeq ORF | 852 |
Synonyms | AMCD1; DA1; DA2B; DA2B4; HEL-S-273; NEM4; TMSB |
Locus ID | 7169 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009] |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403737 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418786 | TPM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403737 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 2 |
CNY 3080.00 |
|
LY418786 | Transient overexpression lysate of tropomyosin 2 (beta) (TPM2), transcript variant 1 |
CNY 3080.00 |
|
PH319648 | TPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003280) |
CNY 19520.00 |
|
TP304007 | Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP319648 | Recombinant protein of human tropomyosin 2 (beta) (TPM2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Tropomyosin 2产品