DP1 (TFDP1) (NM_007111) Human Mass Spec Standard
CAT#: PH303986
TFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_009042)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_009042) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203986 |
| Predicted MW | 45.1 kDa |
| Protein Sequence |
>RC203986 protein sequence
Red=Cloning site Green=Tags(s) MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQQVVIGTPQRP AASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVAD ELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQ RRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDK FEYLFNFDNTFEIHDDIEVLKRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTA GSTSNGTRFSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009042 |
| RefSeq Size | 2651 |
| RefSeq ORF | 1230 |
| Synonyms | DILC; Dp-1; DP1; DRTF1 |
| Locus ID | 7027 |
| Cytogenetics | 13q34 |
| Summary | This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control the transcriptional activity of numerous genes involved in cell cycle progression from G1 to S phase. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1, 15, and X.[provided by RefSeq, Jan 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Cell cycle, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416191 | TFDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416191 | Transient overexpression lysate of transcription factor Dp-1 (TFDP1), transcript variant 1 |
CNY 3080.00 |
|
| TP303986 | Recombinant protein of human transcription factor Dp-1 (TFDP1), transcript variant 1, 20 µg |
CNY 2900.00 |
