PLEKHO1 (NM_016274) Human Mass Spec Standard
CAT#: PH303969
PLEKHO1 MS Standard C13 and N15-labeled recombinant protein (NP_057358)
View other "PLEKHO1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PLEKHO1 MS Standard C13 and N15-labeled recombinant protein (NP_057358) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203969 |
| Predicted MW | 46.2 kDa |
| Protein Sequence |
>RC203969 protein sequence
Red=Cloning site Green=Tags(s) MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVF DLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILD EVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVD LDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRD AASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQ LLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057358 |
| RefSeq Size | 1627 |
| RefSeq ORF | 1227 |
| Synonyms | CKIP-1; CKIP1; JBP; OC120 |
| Locus ID | 51177 |
| Cytogenetics | 1q21.2 |
| Summary | Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414081 | PLEKHO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414081 | Transient overexpression lysate of pleckstrin homology domain containing, family O member 1 (PLEKHO1) |
CNY 3080.00 |
|
| TP303969 | Recombinant protein of human pleckstrin homology domain containing, family O member 1 (PLEKHO1), 20 µg |
CNY 2900.00 |
其它PLEKHO1产品
