PHGDH (NM_006623) Human Mass Spec Standard
CAT#: PH303949
PHGDH MS Standard C13 and N15-labeled recombinant protein (NP_006614)
View other "PHGDH" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PHGDH MS Standard C13 and N15-labeled recombinant protein (NP_006614) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203949 |
| Predicted MW | 56.7 kDa |
| Protein Sequence |
>RC203949 protein sequence
Red=Cloning site Green=Tags(s) MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKL QVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMG TELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLL PSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVIS CPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSP KGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGE CLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGV RLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006614 |
| RefSeq Size | 2021 |
| RefSeq ORF | 1599 |
| Synonyms | 3-PGDH; 3PGDH; HEL-S-113; NLS; NLS1; PDG; PGAD; PGD; PGDH; PHGDHD; SERA |
| Locus ID | 26227 |
| Cytogenetics | 1p12 |
| Summary | This gene encodes the enzyme which is involved in the early steps of L-serine synthesis in animal cells. L-serine is required for D-serine and other amino acid synthesis. The enzyme requires NAD/NADH as a cofactor and forms homotetramers for activity. Mutations in this gene have been found in a family with congenital microcephaly, psychomotor retardation and other symptoms. Multiple alternatively spliced transcript variants have been found, however the full-length nature of most are not known. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401983 | PHGDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401983 | Transient overexpression lysate of phosphoglycerate dehydrogenase (PHGDH) |
CNY 3080.00 |
|
| TP303949 | Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), 20 µg |
CNY 2900.00 |
|
| TP710057 | Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with N-terminal HIS tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
| TP710143 | Recombinant protein of human phosphoglycerate dehydrogenase (PHGDH), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
