Clusterin (CLU) (NM_203339) Human Mass Spec Standard
CAT#: PH303941
CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084)
View other "Clusterin" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CLU MS Standard C13 and N15-labeled recombinant protein (NP_976084) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203941 |
| Predicted MW | 52.5 kDa |
| Protein Sequence |
>RC203941 protein sequence
Red=Cloning site Green=Tags(s) MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL LSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL EEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS LPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDD DRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW KMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP VEVSRKNPKFMETVAEKALQEYRKKHREE SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_976084 |
| RefSeq Size | 3012 |
| RefSeq ORF | 1347 |
| Synonyms | AAG4; APOJ; CLI; KUB1; MGC24903; SGP-2; SGP2; SP-40; TRPM-2; TRPM2 |
| Locus ID | 1191 |
| Cytogenetics | 8p21.1 |
| Summary | The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404400 | CLU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433124 | CLU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404400 | Transient overexpression lysate of clusterin (CLU), transcript variant 2 |
CNY 3080.00 |
|
| LY433124 | Transient overexpression lysate of clusterin (CLU), transcript variant 3 |
CNY 3080.00 |
|
| PH311875 | CLU MS Standard C13 and N15-labeled recombinant protein (NP_001822) |
CNY 19520.00 |
|
| TP303941 | Recombinant protein of human clusterin (CLU), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP311875 | Recombinant protein of human clusterin (CLU), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720381 | Recombinant protein of human clusterin (CLU), transcript variant 1 |
CNY 1800.00 |
其它Clusterin产品


