MRRF (NM_138777) Human Mass Spec Standard
CAT#: PH303909
MRRF MS Standard C13 and N15-labeled recombinant protein (NP_620132)
View other "MRRF" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | MRRF MS Standard C13 and N15-labeled recombinant protein (NP_620132) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203909 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC203909 protein sequence
Red=Cloning site Green=Tags(s) MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAVPVRHFATKKAKAKGKGQSQT RVNINAALVEDIINLEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKS PQLILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRK VRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620132 |
RefSeq Size | 2036 |
RefSeq ORF | 786 |
Synonyms | MRFF; MTRRF; RRF |
Locus ID | 92399 |
Cytogenetics | 9q33.2 |
Summary | This gene encodes a ribosome recycling factor, which is a component of the mitochondrial translational machinery. The encoded protein, along with mitochondrial elongation factor 2, functions in ribosomal recycling at the termination of mitochondrial translation by mediating the disassembly of ribosomes from messenger RNA. A pseudogene of this gene has been identified on chromosome X. [provided by RefSeq, Oct 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404675 | MRRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408516 | MRRF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404675 | Transient overexpression lysate of mitochondrial ribosome recycling factor (MRRF), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
LY408516 | Transient overexpression lysate of mitochondrial ribosome recycling factor (MRRF), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
TP303909 | Recombinant protein of human mitochondrial ribosome recycling factor (MRRF), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP760590 | Purified recombinant protein of Human mitochondrial ribosome recycling factor (MRRF), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP760638 | Purified recombinant protein of Human mitochondrial ribosome recycling factor (MRRF), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |