CNRIP1 (NM_015463) Human Mass Spec Standard
CAT#: PH303901
CNRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_056278)
View other "CNRIP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CNRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_056278) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203901 |
| Predicted MW | 18.6 kDa |
| Protein Sequence |
>RC203901 protein sequence
Red=Cloning site Green=Tags(s) MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVP LELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPF SVIEYECKPNETRSLMWVNKESFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056278 |
| RefSeq Size | 2037 |
| RefSeq ORF | 492 |
| Synonyms | C2orf32; CRIP-1; CRIP1 |
| Locus ID | 25927 |
| Cytogenetics | 2p14 |
| Summary | This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402440 | CNRIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402440 | Transient overexpression lysate of cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a |
CNY 3080.00 |
|
| TP303901 | Recombinant protein of human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a, 20 µg |
CNY 2900.00 |
