Rab5 (RAB5A) (NM_004162) Human Mass Spec Standard
CAT#: PH303873
RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153)
View other "Rab5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | RAB5A MS Standard C13 and N15-labeled recombinant protein (NP_004153) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203873 |
Predicted MW | 23.7 kDa |
Protein Sequence |
>RC203873 protein sequence
Red=Cloning site Green=Tags(s) MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN QCCSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004153 |
RefSeq Size | 2548 |
RefSeq ORF | 645 |
Synonyms | RAB5 |
Locus ID | 5868 |
Cytogenetics | 3p24.3 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes (PubMed:10818110, PubMed:14617813, PubMed:16410077, PubMed:15378032). Contributes to the regulation of filopodia extension (PubMed:14978216). Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan (PubMed:22660413). Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401339 | RAB5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401339 | Transient overexpression lysate of RAB5A, member RAS oncogene family (RAB5A) |
CNY 3080.00 |
|
TP303873 | Recombinant protein of human RAB5A, member RAS oncogene family (RAB5A), 20 µg |
CNY 2900.00 |