BORCS5 (NM_058169) Human Mass Spec Standard
CAT#: PH303844
LOH12CR1 MS Standard C13 and N15-labeled recombinant protein (NP_477517)
View other "BORCS5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | LOH12CR1 MS Standard C13 and N15-labeled recombinant protein (NP_477517) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203844 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC203844 protein sequence
Red=Cloning site Green=Tags(s) MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLL SGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYA KYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_477517 |
| RefSeq Size | 2092 |
| RefSeq ORF | 588 |
| Synonyms | LOH1CR12; LOH12CR1 |
| Locus ID | 118426 |
| Cytogenetics | 12p13.2 |
| Summary | As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409223 | LOH12CR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409223 | Transient overexpression lysate of loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1) |
CNY 3080.00 |
|
| TP303844 | Recombinant protein of human loss of heterozygosity, 12, chromosomal region 1 (LOH12CR1), 20 µg |
CNY 2900.00 |
