CHI3L2 (NM_001025199) Human Mass Spec Standard
CAT#: PH303807
CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020370)
View other "CHI3L2" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020370) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203807 |
Predicted MW | 43.5 kDa |
Protein Sequence |
>RC203807 protein sequence
Red=Cloning site Green=Tags(s) MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNK VIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGL DVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLL SFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAET TVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001020370 |
RefSeq Size | 1516 |
RefSeq ORF | 1173 |
Synonyms | CHIL2; YKL-39; YKL39 |
Locus ID | 1117 |
Cytogenetics | 1p13.2 |
Summary | The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400404 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418266 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422601 | CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400404 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 3 |
CNY 3080.00 |
|
LY418266 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 1 |
CNY 3080.00 |
|
LY422601 | Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 2 |
CNY 3080.00 |
|
PH320804 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_003991) |
CNY 19520.00 |
|
PH320858 | CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020368) |
CNY 19520.00 |
|
TP303807 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP320804 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP320858 | Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 2, 20 µg |
CNY 2900.00 |