STAR (NM_000349) Human Mass Spec Standard
CAT#: PH303803
STAR MS Standard C13 and N15-labeled recombinant protein (NP_000340)
View other "STAR" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | STAR MS Standard C13 and N15-labeled recombinant protein (NP_000340) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203803 |
Predicted MW | 31.9 kDa |
Protein Sequence |
>RC203803 protein sequence
Red=Cloning site Green=Tags(s) MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLGSRLEETLYSD QELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVER MEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGMATDFGNMP EQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPA SEARC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000340 |
RefSeq Size | 2695 |
RefSeq ORF | 855 |
Synonyms | STARD1 |
Locus ID | 6770 |
Cytogenetics | 8p11.23 |
Summary | The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423465 | STAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424767 | STAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425216 | STAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423465 | Transient overexpression lysate of steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
LY424767 | Transient overexpression lysate of steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
PH313299 | STAR MS Standard C13 and N15-labeled recombinant protein (NP_001007244) |
CNY 14250.00 |
|
TP303803 | Purified recombinant protein of Homo sapiens steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP313299 | Purified recombinant protein of Homo sapiens steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP761908 | Purified recombinant protein of Human steroidogenic acute regulatory protein (STAR), nuclear gene encoding mitochondrial protein, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |