TFAP4 (NM_003223) Human Mass Spec Standard
CAT#: PH303773
TFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_003214)
View other "TFAP4" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | TFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_003214) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC203773 | 
| Predicted MW | 38.7 kDa | 
| Protein Sequence | 
                 >RC203773 protein sequence 
Red=Cloning site Green=Tags(s) MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQS LKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSP DIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQE KLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIE GTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_003214 | 
| RefSeq Size | 2147 | 
| RefSeq ORF | 1014 | 
| Synonyms | AP-4; bHLHc41 | 
| Locus ID | 7023 | 
| Cytogenetics | 16p13.3 | 
| Summary | Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM, Jul 2009] | 
| Protein Families | Druggable Genome, Transcription Factors | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401113 | TFAP4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401113 | Transient overexpression lysate of transcription factor AP-4 (activating enhancer binding protein 4) (TFAP4) | 
                                                     CNY 3080.00  | 
                                            |
| TP303773 | Recombinant protein of human transcription factor AP-4 (activating enhancer binding protein 4) (TFAP4), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
