LTA (NM_000595) Human Mass Spec Standard
CAT＃: PH303741
LTA MS Standard C13 and N15-labeled recombinant protein (NP_000586)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | LTA MS Standard C13 and N15-labeled recombinant protein (NP_000586) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203741 |
| Predicted MW | 22.3 kDa |
| Protein Sequence |
>RC203741 protein sequence
Red=Cloning site Green=Tags(s) MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000586 |
| RefSeq Size | 1423 |
| RefSeq ORF | 615 |
| Synonyms | LT; TNFB; TNFSF1; TNLG1E |
| Locus ID | 4049 |
| Cytogenetics | 6p21.33 |
| Summary | The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Antigen processing and presentation, Cytokine-cytokine receptor interaction, Type I diabetes mellitus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424627 | LTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431786 | LTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424627 | Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 |
CNY 3080.00 |
|
| LY431786 | Transient overexpression lysate of lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1 |
CNY 3080.00 |
|
| TP303741 | Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA), 20 µg |
CNY 2900.00 |
|
| TP328758 | Recombinant protein of human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720614 | Purified recombinant protein of Human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2 |
CNY 1800.00 |
