Reticulocalbin 3 (RCN3) (NM_020650) Human Mass Spec Standard
CAT#: PH303708
RCN3 MS Standard C13 and N15-labeled recombinant protein (NP_065701)
View other "Reticulocalbin 3" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | RCN3 MS Standard C13 and N15-labeled recombinant protein (NP_065701) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC203708 | 
| Predicted MW | 37.5 kDa | 
| Protein Sequence | 
                 >RC203708 protein sequence 
Red=Cloning site Green=Tags(s) MMWRPSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQ LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRN ATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLE DLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLV EANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_065701 | 
| RefSeq Size | 1882 | 
| RefSeq ORF | 984 | 
| Synonyms | RLP49 | 
| Locus ID | 57333 | 
| Cytogenetics | 19q13.33 | 
| Summary | Probable molecular chaperone assisting protein biosynthesis and transport in the endoplasmic reticulum (PubMed:16433634, PubMed:28939891). Required for the proper biosynthesis and transport of pulmonary surfactant-associated protein A/SP-A, pulmonary surfactant-associated protein D/SP-D and the lipid transporter ABCA3 (By similarity). By regulating both the proper expression and the degradation through the endoplasmic reticulum-associated protein degradation pathway of these proteins plays a crucial role in pulmonary surfactant homeostasis (By similarity). Has an anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens (PubMed:28939891). This calcium-binding protein also transiently associates with immature PCSK6 and regulates its secretion (PubMed:16433634).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402802 | RCN3 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY402802 | Transient overexpression lysate of reticulocalbin 3, EF-hand calcium binding domain (RCN3) | 
                                                     CNY 3080.00  | 
                                            |
| TP303708 | Recombinant protein of human reticulocalbin 3, EF-hand calcium binding domain (RCN3), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它Reticulocalbin 3产品
