Macro H2A.2 (H2AFY2) (NM_018649) Human Mass Spec Standard
CAT#: PH303699
H2AFY2 MS Standard C13 and N15-labeled recombinant protein (NP_061119)
View other "Macro H2A.2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | H2AFY2 MS Standard C13 and N15-labeled recombinant protein (NP_061119) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203699 |
| Predicted MW | 40.1 kDa |
| Protein Sequence |
>RC203699 protein sequence
Red=Cloning site Green=Tags(s) MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARD NKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKAT SGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSM RVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQ WGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVY FLLFDSESIGIYVQEMAKLDAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061119 |
| RefSeq Size | 2181 |
| RefSeq ORF | 1116 |
| Synonyms | H2AFY2 |
| Locus ID | 55506 |
| Cytogenetics | 10q22.1 |
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and may participate in stable X chromosome inactivation. [provided by RefSeq, Oct 2015] |
| Protein Pathways | Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412957 | H2AFY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412957 | Transient overexpression lysate of H2A histone family, member Y2 (H2AFY2) |
CNY 3080.00 |
|
| TP303699 | Recombinant protein of human H2A histone family, member Y2 (H2AFY2), 20 µg |
CNY 2900.00 |
其它Macro H2A.2产品
