PAGE5 (NM_130467) Human Mass Spec Standard
CAT#: PH303636
PAGE5 MS Standard C13 and N15-labeled recombinant protein (NP_569734)
View other "PAGE5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | PAGE5 MS Standard C13 and N15-labeled recombinant protein (NP_569734) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203636 |
Predicted MW | 14 kDa |
Protein Sequence |
>RC203636 protein sequence
Red=Cloning site Green=Tags(s) MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAP SGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_569734 |
RefSeq Size | 760 |
RefSeq ORF | 390 |
Synonyms | CT16; CT16.1; CT16.2; GAGEE1; PAGE-5 |
Locus ID | 90737 |
Cytogenetics | Xp11.21 |
Summary | This gene is a member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jan 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408917 | PAGE5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408917 | Transient overexpression lysate of P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1 |
CNY 3080.00 |
|
TP303636 | Purified recombinant protein of Homo sapiens P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1, 20 µg |
CNY 2900.00 |