SMCR7L (MIEF1) (NM_019008) Human Mass Spec Standard
CAT#: PH303568
SMCR7L MS Standard C13 and N15-labeled recombinant protein (NP_061881)
View other "SMCR7L" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SMCR7L MS Standard C13 and N15-labeled recombinant protein (NP_061881) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203568 |
Predicted MW | 51.3 kDa |
Protein Sequence |
>RC203568 protein sequence
Red=Cloning site Green=Tags(s) MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRS WEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLL TYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVL EQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIG SLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLR ALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLE AGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061881 |
RefSeq Size | 5730 |
RefSeq ORF | 1389 |
Synonyms | AltMIEF1; dJ1104E15.3; HSU79252; MID51; MIEF1-MP; SMCR7L |
Locus ID | 54471 |
Cytogenetics | 22q13.1 |
Summary | Mitochondrial outer membrane protein which regulates mitochondrial fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity and DNM1L oligomerization. Binds ADP and can also bind GDP, although with lower affinity. Does not bind CDP, UDP, ATP, AMP or GTP. Inhibits DNM1L GTPase activity in the absence of bound ADP. Requires ADP to stimulate DNM1L GTPase activity and the assembly of DNM1L into long, oligomeric tubules with a spiral pattern, as opposed to the ring-like DNM1L oligomers observed in the absence of bound ADP. Does not require ADP for its function in recruiting DNM1L.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412846 | MIEF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412846 | Transient overexpression lysate of Smith-Magenis syndrome chromosome region, candidate 7-like (SMCR7L) |
CNY 3080.00 |
|
TP303568 | Recombinant protein of human Smith-Magenis syndrome chromosome region, candidate 7-like (SMCR7L), 20 µg |
CNY 2900.00 |