Ketosamine 3 kinase (FN3KRP) (NM_024619) Human Mass Spec Standard
CAT#: PH303554
FN3KRP MS Standard C13 and N15-labeled recombinant protein (NP_078895)
View other "Ketosamine 3 kinase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FN3KRP MS Standard C13 and N15-labeled recombinant protein (NP_078895) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203554 |
| Predicted MW | 34.4 kDa |
| Protein Sequence |
>RC203554 protein sequence
Red=Cloning site Green=Tags(s) MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKV PKPIKVLDAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFV ARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMDMVEKESGDREALQLWSALQLKIPDLFRDLEII PALLHGDLWGGNVAEDSSGPVIFDPASFYGHSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLY QLFHYLNHWNHFGSGYRGSSLNIMRNLVK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_078895 |
| RefSeq Size | 1844 |
| RefSeq ORF | 927 |
| Synonyms | FN3KL |
| Locus ID | 79672 |
| Cytogenetics | 17q25.3 |
| Summary | A high concentration of glucose can result in non-enzymatic oxidation of proteins by reaction of glucose and lysine residues (glycation). Proteins modified in this way are less active or functional. This gene encodes an enzyme which catalyzes the phosphorylation of psicosamines and ribulosamines compared to the neighboring gene which encodes a highly similar enzyme, fructosamine-3-kinase, which has different substrate specificity. The activity of both enzymes may result in deglycation of proteins to restore their function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411188 | FN3KRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411188 | Transient overexpression lysate of fructosamine 3 kinase related protein (FN3KRP) |
CNY 3080.00 |
|
| TP303554 | Recombinant protein of human fructosamine 3 kinase related protein (FN3KRP), 20 µg |
CNY 2900.00 |
其它Ketosamine 3 kinase产品
