EIF3K (NM_013234) Human Mass Spec Standard
CAT#: PH303529
EIF3K MS Standard C13 and N15-labeled recombinant protein (NP_037366)
View other "EIF3K" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | EIF3K MS Standard C13 and N15-labeled recombinant protein (NP_037366) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203529 |
| Predicted MW | 25.1 kDa |
| Protein Sequence |
>RC203529 protein sequence
Red=Cloning site Green=Tags(s) MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL LKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRK FICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSV SSIMASSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_037366 |
| RefSeq Size | 898 |
| RefSeq ORF | 654 |
| Synonyms | ARG134; EIF3-p28; EIF3S12; HSPC029; M9; MSTP001; PLAC-24; PLAC24; PRO1474; PTD001 |
| Locus ID | 27335 |
| Cytogenetics | 19q13.2 |
| Summary | The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415721 | EIF3K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415721 | Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit K (EIF3K) |
CNY 3080.00 |
|
| TP303529 | Recombinant protein of human eukaryotic translation initiation factor 3, subunit K (EIF3K), 20 µg |
CNY 2900.00 |
