ATP6V0D1 (NM_004691) Human Mass Spec Standard
CAT#: PH303498
ATP6V0D1 MS Standard C13 and N15-labeled recombinant protein (NP_004682)
View other "ATP6V0D1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ATP6V0D1 MS Standard C13 and N15-labeled recombinant protein (NP_004682) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203498 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC203498 protein sequence
Red=Cloning site Green=Tags(s) MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVI DDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEA VNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCP ILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEG AGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPI F myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004682 |
RefSeq Size | 1688 |
RefSeq ORF | 1053 |
Synonyms | ATP6D; ATP6DV; P39; VATX; VMA6; VPATPD |
Locus ID | 9114 |
Cytogenetics | 16q22.1 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq, Jul 2008] |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417820 | ATP6V0D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417820 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1) |
CNY 3080.00 |
|
TP303498 | Recombinant protein of human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 (ATP6V0D1), 20 µg |
CNY 2900.00 |
其它ATP6V0D1产品