D4 (ARHGDIB) (NM_001175) Human Mass Spec Standard
CAT#: PH303496
ARHGDIB MS Standard C13 and N15-labeled recombinant protein (NP_001166)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ARHGDIB MS Standard C13 and N15-labeled recombinant protein (NP_001166) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203496 |
| Predicted MW | 23 kDa |
| Protein Sequence |
>RC203496 protein sequence
Red=Cloning site Green=Tags(s) MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVT RLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKAT FMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001166 |
| RefSeq Size | 1216 |
| RefSeq ORF | 603 |
| Synonyms | D4; GDIA2; GDID4; Ly-GDI; LYGDI; RAP1GN1; RhoGDI2 |
| Locus ID | 397 |
| Cytogenetics | 12p12.3 |
| Summary | Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases (summary by Scherle et al., 1993 [PubMed 8356058]).[supplied by OMIM, Dec 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Neurotrophin signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400471 | ARHGDIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400471 | Transient overexpression lysate of Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB) |
CNY 3080.00 |
|
| TP303496 | Recombinant protein of human Rho GDP dissociation inhibitor (GDI) beta (ARHGDIB), 20 µg |
CNY 2900.00 |
