POLR1C (NM_203290) Human Mass Spec Standard
CAT#: PH303486
POLR1C MS Standard C13 and N15-labeled recombinant protein (NP_976035)
View other "POLR1C" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | POLR1C MS Standard C13 and N15-labeled recombinant protein (NP_976035) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203486 |
| Predicted MW | 39.2 kDa |
| Protein Sequence |
>RC203486 protein sequence
Red=Cloning site Green=Tags(s) MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA AIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQF RLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDL LMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRL DTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_976035 |
| RefSeq Size | 1353 |
| RefSeq ORF | 1038 |
| Synonyms | AC40; HLD11; RPA5; RPA39; RPA40; RPAC1; RPC40; TCS3 |
| Locus ID | 9533 |
| Cytogenetics | 6p21.1 |
| Summary | The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Mutations in this gene have been associated with Treacher Collins syndrome (TCS) and hypomyelinating leukodystrophy 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404374 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417693 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429225 | POLR1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404374 | Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1 |
CNY 3080.00 |
|
| LY417693 | Transient overexpression lysate of polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 2 |
CNY 3080.00 |
|
| TP303486 | Recombinant protein of human polymerase (RNA) I polypeptide C, 30kDa (POLR1C), transcript variant 1, 20 µg |
CNY 2900.00 |
