Phosphatidic acid phosphatase type 2B (PLPP3) (NM_003713) Human Mass Spec Standard
CAT#: PH303480
PPAP2B MS Standard C13 and N15-labeled recombinant protein (NP_003704)
View other "Phosphatidic acid phosphatase type 2B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PPAP2B MS Standard C13 and N15-labeled recombinant protein (NP_003704) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203480 |
Predicted MW | 35.1 kDa |
Protein Sequence |
>RC203480 protein sequence
Red=Cloning site Green=Tags(s) MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT KMTLSLPAPAIRKEILSPVDIIDRNNHHNMM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003704 |
RefSeq Size | 3324 |
RefSeq ORF | 933 |
Synonyms | Dri42; LPP3; PAP2B; PPAP2B; VCIP |
Locus ID | 8613 |
Cytogenetics | 1p32.2 |
Summary | The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Ether lipid metabolism, Fc gamma R-mediated phagocytosis, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418485 | PPAP2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418485 | Transient overexpression lysate of phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 1 |
CNY 3080.00 |
|
TP303480 | Recombinant protein of human phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Phosphatidic acid phosphatase type 2B产品