MRPS22 (NM_020191) Human Mass Spec Standard
CAT#: PH303424
MRPS22 MS Standard C13 and N15-labeled recombinant protein (NP_064576)
View other "MRPS22" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MRPS22 MS Standard C13 and N15-labeled recombinant protein (NP_064576) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203424 |
| Predicted MW | 41.3 kDa |
| Protein Sequence |
>RC203424 protein sequence
Red=Cloning site Green=Tags(s) MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTF MDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPIND VLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIF KEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKK IDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQ EALSRHSAAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064576 |
| RefSeq Size | 1155 |
| RefSeq ORF | 1080 |
| Synonyms | C3orf5; COXPD5; GIBT; GK002; MRP-S22; ODG7; RPMS22 |
| Locus ID | 56945 |
| Cytogenetics | 3q23 |
| Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that does not seem to have a counterpart in prokaryotic and fungal-mitochondrial ribosomes. This gene lies telomeric of and is transcribed in the opposite direction from the forkhead box L2 gene. A pseudogene corresponding to this gene is found on chromosome Xq. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412613 | MRPS22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412613 | Transient overexpression lysate of mitochondrial ribosomal protein S22 (MRPS22), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP303424 | Recombinant protein of human mitochondrial ribosomal protein S22 (MRPS22), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
