CIAO2A (NM_032231) Human Mass Spec Standard
CAT#: PH303357
FAM96A MS Standard C13 and N15-labeled recombinant protein (NP_115607)
View other "CIAO2A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FAM96A MS Standard C13 and N15-labeled recombinant protein (NP_115607) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203357 |
Predicted MW | 18.4 kDa |
Protein Sequence |
>RC203357 protein sequence
Red=Cloning site Green=Tags(s) MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQ EINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVA AAMENPNLREIVEQCVLEPD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115607 |
RefSeq Size | 1114 |
RefSeq ORF | 480 |
Synonyms | CIA2A; FAM96A |
Locus ID | 84191 |
Cytogenetics | 15q22.31 |
Summary | Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:23891004). As a CIA complex component and in collaboration with CIAO1 specifically matures ACO1 and stabilizes IREB2, connecting cytosolic iron-sulfur protein maturation with cellular iron regulation (PubMed:23891004). May play a role in chromosome segregation through establishment of sister chromatid cohesion. May induce apoptosis in collaboration with APAF1 (PubMed:25716227).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410258 | FAM96A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410258 | Transient overexpression lysate of family with sequence similarity 96, member A (FAM96A), transcript variant 1 |
CNY 3080.00 |
|
TP303357 | Recombinant protein of human family with sequence similarity 96, member A (FAM96A), transcript variant 1, 20 µg |
CNY 2900.00 |