BAP29 (BCAP29) (NM_018844) Human Mass Spec Standard
CAT＃: PH303331
BCAP29 MS Standard C13 and N15-labeled recombinant protein (NP_061332)
View other "BAP29" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | BCAP29 MS Standard C13 and N15-labeled recombinant protein (NP_061332) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203331 |
| Predicted MW | 28.3 kDa |
| Protein Sequence |
>RC203331 protein sequence
Red=Cloning site Green=Tags(s) MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM QSERLSKEYDQLLKEHSELQDRLERGNKKRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061332 |
| RefSeq Size | 6034 |
| RefSeq ORF | 723 |
| Synonyms | BAP29 |
| Locus ID | 55973 |
| Cytogenetics | 7q22.3 |
| Summary | May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412884 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423427 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423428 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425235 | BCAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412884 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 2 |
CNY 3080.00 |
|
| LY423427 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 1 |
CNY 3080.00 |
|
| LY423428 | Transient overexpression lysate of B-cell receptor-associated protein 29 (BCAP29), transcript variant 3 |
CNY 3080.00 |
|
| TP303331 | Recombinant protein of human B-cell receptor-associated protein 29 (BCAP29), transcript variant 2, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
