HINT1 (NM_005340) Human Mass Spec Standard
CAT#: PH303319
HINT1 MS Standard C13 and N15-labeled recombinant protein (NP_005331)
View other "HINT1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HINT1 MS Standard C13 and N15-labeled recombinant protein (NP_005331) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203319 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC203319 protein sequence
Red=Cloning site Green=Tags(s) MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDD ESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005331 |
RefSeq Size | 689 |
RefSeq ORF | 378 |
Synonyms | HINT; NMAN; PKCI-1; PRKCNH1 |
Locus ID | 3094 |
Cytogenetics | 5q23.3 |
Summary | This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417372 | HINT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417372 | Transient overexpression lysate of histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1 |
CNY 3080.00 |
|
TP303319 | Recombinant protein of human histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1, 20 µg |
CNY 2900.00 |