CISD1 (NM_018464) Human Mass Spec Standard
CAT#: PH303308
CISD1 MS Standard C13 and N15-labeled recombinant protein (NP_060934)
View other "CISD1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CISD1 MS Standard C13 and N15-labeled recombinant protein (NP_060934) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203308 |
| Predicted MW | 12.2 kDa |
| Protein Sequence |
>RC203308 protein sequence
Red=Cloning site Green=Tags(s) MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060934 |
| RefSeq Size | 2115 |
| RefSeq ORF | 324 |
| Synonyms | C10orf70; MDS029; mitoNEET; ZCD1 |
| Locus ID | 55847 |
| Cytogenetics | 10q21.1 |
| Summary | This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2. [provided by RefSeq, Feb 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413042 | CISD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413042 | Transient overexpression lysate of CDGSH iron sulfur domain 1 (CISD1) |
CNY 3080.00 |
|
| TP303308 | Recombinant protein of human CDGSH iron sulfur domain 1 (CISD1), 20 µg |
CNY 2900.00 |
