RHOA (NM_001664) Human Mass Spec Standard
CAT#: PH303303
RHOA MS Standard C13 and N15-labeled recombinant protein (NP_001655)
View other "RHOA" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RHOA MS Standard C13 and N15-labeled recombinant protein (NP_001655) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203303 |
Predicted MW | 21.8 kDa |
Protein Sequence |
>RC203303 protein sequence
Red=Cloning site Green=Tags(s) MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001655 |
RefSeq Size | 1926 |
RefSeq ORF | 579 |
Synonyms | ARH12; ARHA; EDFAOB; RHO12; RHOH12 |
Locus ID | 387 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Axon guidance, Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, T cell receptor signaling pathway, TGF-beta signaling pathway, Tight junction, Vascular smooth muscle contraction, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400630 | RHOA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400630 | Transient overexpression lysate of ras homolog gene family, member A (RHOA) |
CNY 3080.00 |
|
TP303303 | Recombinant protein of human ras homolog gene family, member A (RHOA), 20 µg |
CNY 2900.00 |