G gamma12 (GNG12) (NM_018841) Human Mass Spec Standard
CAT#: PH303268
GNG12 MS Standard C13 and N15-labeled recombinant protein (NP_061329)
View other "G gamma12" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | GNG12 MS Standard C13 and N15-labeled recombinant protein (NP_061329) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203268 |
Predicted MW | 7.9 kDa |
Protein Sequence |
>RC203268 protein sequence
Red=Cloning site Green=Tags(s) MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI IL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061329 |
RefSeq Size | 4427 |
RefSeq ORF | 216 |
Locus ID | 55970 |
Cytogenetics | 1p31.3 |
Summary | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412881 | GNG12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412881 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 12 (GNG12) |
CNY 3080.00 |
|
TP303268 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 12 (GNG12), 20 µg |
CNY 2900.00 |
其它G gamma12产品