LSM5 (NM_012322) Human Mass Spec Standard
CAT#: PH303266
LSM5 MS Standard C13 and N15-labeled recombinant protein (NP_036454)
View other "LSM5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LSM5 MS Standard C13 and N15-labeled recombinant protein (NP_036454) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203266 |
| Predicted MW | 9.9 kDa |
| Protein Sequence |
>RC203266 protein sequence
Red=Cloning site Green=Tags(s) MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD QILLNGNNITMLVPGGEGPEV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036454 |
| RefSeq Size | 2275 |
| RefSeq ORF | 273 |
| Synonyms | YER146W |
| Locus ID | 23658 |
| Cytogenetics | 7p14.3 |
| Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | RNA degradation, Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415800 | LSM5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415800 | Transient overexpression lysate of LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1 |
CNY 3080.00 |
|
| TP303266 | Recombinant protein of human LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM5), transcript variant 1, 20 µg |
CNY 2900.00 |
