Melanoma Inhibitory Activity (MIA) (NM_006533) Human Mass Spec Standard
CAT#: PH303245
MIA MS Standard C13 and N15-labeled recombinant protein (NP_006524)
View other "Melanoma Inhibitory Activity" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MIA MS Standard C13 and N15-labeled recombinant protein (NP_006524) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203245 |
| Predicted MW | 14.5 kDa |
| Protein Sequence |
>RC203245 protein sequence
Red=Cloning site Green=Tags(s) MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006524 |
| RefSeq Size | 654 |
| RefSeq ORF | 393 |
| Synonyms | CD-RAP |
| Locus ID | 8190 |
| Cytogenetics | 19q13.2 |
| Summary | Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401957 | MIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401957 | Transient overexpression lysate of melanoma inhibitory activity (MIA) |
CNY 3080.00 |
|
| TP303245 | Recombinant protein of human melanoma inhibitory activity (MIA), 20 µg |
CNY 2900.00 |
|
| TP720129 | Recombinant protein of human melanoma inhibitory activity (MIA) |
CNY 1800.00 |
其它Melanoma Inhibitory Activity产品
