ENY2 (NM_020189) Human Mass Spec Standard
CAT#: PH303231
ENY2 MS Standard C13 and N15-labeled recombinant protein (NP_064574)
View other "ENY2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ENY2 MS Standard C13 and N15-labeled recombinant protein (NP_064574) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203231 |
Predicted MW | 11.5 kDa |
Protein Sequence |
>RC203231 protein sequence
Red=Cloning site Green=Tags(s) MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE ITPKGRALVPDSVKKELLQRIRTFLAQHASL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_064574 |
RefSeq Size | 2948 |
RefSeq ORF | 303 |
Synonyms | DC6; e(y)2; Sus1 |
Locus ID | 56943 |
Cytogenetics | 8q23.1 |
Summary | Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation (PubMed:18206972, PubMed:21746879). As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (PubMed:23591820).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412611 | ENY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412611 | Transient overexpression lysate of enhancer of yellow 2 homolog (Drosophila) (ENY2) |
CNY 3080.00 |
|
TP303231 | Recombinant protein of human enhancer of yellow 2 homolog (Drosophila) (ENY2), 20 µg |
CNY 2900.00 |