Inhibin beta A (INHBA) (NM_002192) Human Mass Spec Standard
CAT#: PH303226
INHBA MS Standard C13 and N15-labeled recombinant protein (NP_002183)
View other "Inhibin beta A" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | INHBA MS Standard C13 and N15-labeled recombinant protein (NP_002183) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203226 |
| Predicted MW | 47.4 kDa |
| Protein Sequence |
>RC203226 protein sequence
Red=Cloning site Green=Tags(s) MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKK RPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEI SKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKV VDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAG ADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYC EGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV EECGCS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002183 |
| RefSeq Size | 2175 |
| RefSeq ORF | 1278 |
| Synonyms | EDF; FRP |
| Locus ID | 3624 |
| Cytogenetics | 7p14.1 |
| Summary | This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients. [provided by RefSeq, Aug 2016] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400796 | INHBA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400796 | Transient overexpression lysate of inhibin, beta A (INHBA) |
CNY 3080.00 |
|
| TP303226 | Recombinant protein of human inhibin, beta A (INHBA), 20 µg |
CNY 2900.00 |
|
| TP762679 | Purified recombinant protein of Human inhibin, beta A (INHBA), 259Lys-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2480.00 |
其它Inhibin beta A产品
