TXNDC17 (NM_032731) Human Mass Spec Standard
CAT#: PH303220
TXNDC17 MS Standard C13 and N15-labeled recombinant protein (NP_116120)
View other "TXNDC17" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | TXNDC17 MS Standard C13 and N15-labeled recombinant protein (NP_116120) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203220 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC203220 protein sequence
Red=Cloning site Green=Tags(s) MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQ VGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116120 |
RefSeq Size | 2075 |
RefSeq ORF | 369 |
Synonyms | TRP14; TXNL5 |
Locus ID | 84817 |
Cytogenetics | 17p13.1 |
Summary | Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409967 | TXNDC17 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409967 | Transient overexpression lysate of thioredoxin domain containing 17 (TXNDC17) |
CNY 3080.00 |
|
TP303220 | Recombinant protein of human thioredoxin domain containing 17 (TXNDC17), 20 µg |
CNY 2900.00 |
其它TXNDC17产品