SRP14 (NM_003134) Human Mass Spec Standard
CAT#: PH303212
SRP14 MS Standard C13 and N15-labeled recombinant protein (NP_003125)
View other "SRP14" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SRP14 MS Standard C13 and N15-labeled recombinant protein (NP_003125) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203212 |
| Predicted MW | 14.4 kDa |
| Protein Sequence |
>RC203212 representing NM_003134
Red=Cloning site Green=Tags(s) MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003125 |
| RefSeq Size | 800 |
| RefSeq ORF | 408 |
| Synonyms | ALURBP |
| Locus ID | 6727 |
| Cytogenetics | 15q15.1 |
| Summary | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Protein export |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418877 | SRP14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418877 | Transient overexpression lysate of signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) |
CNY 3080.00 |
|
| TP303212 | Recombinant protein of human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), 20 µg |
CNY 2900.00 |
