EEF1D (NM_001960) Human Mass Spec Standard
CAT#: PH303202
EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001951)
View other "EEF1D" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
Product Data | |
Description | EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001951) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203202 |
Predicted MW | 71.4 kDa |
Protein Sequence |
>RC203202 protein sequence
Red=Cloning site Green=Tags(s) MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGS RRDPRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPP ALAPWGLCTHGNQVACHHVTWGIWVNKSSFDQAERAFVEWSQALLLAPEGSRRQGTPNTGQQVAVPDLAH QPSPPVNGQPPLGSLQALVREVWLEKPRYDAAERGFYEALFDGHPPGKVRLQERAGLAEGARRGRRDRRG RNILGNKRAGLRRADGEAPSALPYCYFLQKDAEAPWLSKPAYDSAECRHHAAEALRVAWCLEAASLSHRP GPRSGLSVSSLRPNRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARAR ENIQKSLAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRA TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVA KSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEIT KFEEHVQSVDIAAFNKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001951 |
RefSeq Size | 1276 |
RefSeq ORF | 1944 |
Synonyms | EF-1D; EF1D; FP1047 |
Locus ID | 1936 |
Cytogenetics | 8q24.3 |
Summary | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.[provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410171 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC419621 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427131 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427133 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427135 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410171 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1 |
CNY 4840.00 |
|
LY419621 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2 |
CNY 3080.00 |
|
LY427131 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 3 |
CNY 3080.00 |
|
LY427133 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5 |
CNY 3080.00 |
|
LY427135 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 6 |
CNY 3080.00 |
|
PH325386 | EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001123527) |
CNY 19520.00 |
|
TP303202 | Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP325386 | Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5, 20 µg |
CNY 2900.00 |
|
TP760795 | Purified recombinant protein of Human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |