TRIP15 (COPS2) (NM_004236) Human Mass Spec Standard
CAT#: PH303159
COPS2 MS Standard C13 and N15-labeled recombinant protein (NP_004227)
View other "TRIP15" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | COPS2 MS Standard C13 and N15-labeled recombinant protein (NP_004227) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203159 |
| Predicted MW | 51.6 kDa |
| Protein Sequence |
>RC203159 protein sequence
Red=Cloning site Green=Tags(s) MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFK ALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALK DAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKN NKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYL VLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGAR YTALDKWTNQLNSLNQAVVSKLA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004227 |
| RefSeq Size | 4103 |
| RefSeq ORF | 1329 |
| Synonyms | ALIEN; CSN2; SGN2; TRIP15 |
| Locus ID | 9318 |
| Cytogenetics | 15q21.1 |
| Summary | Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401357 | COPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428394 | COPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401357 | Transient overexpression lysate of COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) (COPS2), transcript variant 1 |
CNY 3080.00 |
|
| LY428394 | Transient overexpression lysate of COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) (COPS2), transcript variant 2 |
CNY 3080.00 |
|
| TP303159 | Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) (COPS2), transcript variant 1, 20 µg |
CNY 2900.00 |
