NAT8 (NM_003960) Human Mass Spec Standard
CAT#: PH303157
NAT8 MS Standard C13 and N15-labeled recombinant protein (NP_003951)
View other "NAT8" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NAT8 MS Standard C13 and N15-labeled recombinant protein (NP_003951) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203157 |
| Predicted MW | 25.6 kDa |
| Protein Sequence |
>RC203157 protein sequence
Red=Cloning site Green=Tags(s) MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISL FPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLF HLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVAL HTVHFIYHLPSSKVGSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003951 |
| RefSeq Size | 1073 |
| RefSeq ORF | 681 |
| Synonyms | ATase2; CCNAT; CML1; GLA; Hcml1; TSC501; TSC510 |
| Locus ID | 9027 |
| Cytogenetics | 2p13.1 |
| Summary | This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene. [provided by RefSeq, Sep 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401303 | NAT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401303 | Transient overexpression lysate of N-acetyltransferase 8 (GCN5-related, putative) (NAT8) |
CNY 3080.00 |
|
| TP303157 | Recombinant protein of human N-acetyltransferase 8 (GCN5-related, putative) (NAT8), 20 µg |
CNY 2900.00 |
