PFDN4 (NM_002623) Human Mass Spec Standard
CAT#: PH303137
PFDN4 MS Standard C13 and N15-labeled recombinant protein (NP_002614)
View other "PFDN4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PFDN4 MS Standard C13 and N15-labeled recombinant protein (NP_002614) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203137 |
Predicted MW | 15.3 kDa |
Protein Sequence |
>RC203137 protein sequence
Red=Cloning site Green=Tags(s) MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQ IGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002614 |
RefSeq Size | 1383 |
RefSeq ORF | 402 |
Synonyms | C1; PFD4 |
Locus ID | 5203 |
Cytogenetics | 20q13.2 |
Summary | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419198 | PFDN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419198 | Transient overexpression lysate of prefoldin subunit 4 (PFDN4) |
CNY 3080.00 |
|
TP303137 | Recombinant protein of human prefoldin subunit 4 (PFDN4), 20 µg |
CNY 2900.00 |
|
TP720516 | Recombinant protein of human prefoldin subunit 4 (PFDN4) |
CNY 1800.00 |