PI3 (NM_002638) Human Mass Spec Standard
CAT#: PH303136
PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203136 |
| Predicted MW | 12.3 kDa |
| Protein Sequence |
>RC203136 protein sequence
Red=Cloning site Green=Tags(s) MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002629 |
| RefSeq Size | 579 |
| RefSeq ORF | 351 |
| Synonyms | cementoin; ESI; SKALP; WAP3; WFDC14 |
| Locus ID | 5266 |
| Cytogenetics | 20q13.12 |
| Summary | This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. [provided by RefSeq, Oct 2014] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400936 | PI3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400936 | Transient overexpression lysate of peptidase inhibitor 3, skin-derived (PI3) |
CNY 3080.00 |
|
| TP303136 | Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3), 20 µg |
CNY 2900.00 |
|
| TP720751 | Purified recombinant protein of Human peptidase inhibitor 3, skin-derived (PI3) |
CNY 1800.00 |
