GCDFP 15 (PIP) (NM_002652) Human Mass Spec Standard
CAT#: PH303135
PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643)
View other "GCDFP 15" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203135 |
| Predicted MW | 16.6 kDa |
| Protein Sequence |
>RC203135 protein sequence
Red=Cloning site Green=Tags(s) MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI EILKVE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002643 |
| RefSeq Size | 591 |
| RefSeq ORF | 438 |
| Synonyms | GCDFP-15; GCDFP15; GPIP4 |
| Locus ID | 5304 |
| Cytogenetics | 7q34 |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419186 | PIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419186 | Transient overexpression lysate of prolactin-induced protein (PIP) |
CNY 3080.00 |
|
| TP303135 | Recombinant protein of human prolactin-induced protein (PIP), 20 µg |
CNY 2900.00 |
|
| TP701042 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with C-terminal His tag, expressed in HEK293 cells, 50ug |
CNY 7820.00 |
|
| TP710252 | Purified recombinant protein of Human prolactin-induced protein (PIP), residues aa29–end, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
| TP762416 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
其它GCDFP 15产品


