Myosin light chain 3 (MYL3) (NM_000258) Human Mass Spec Standard
CAT#: PH303122
MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249)
View other "Myosin light chain 3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203122 |
| Predicted MW | 21.9 kDa |
| Protein Sequence |
>RC203122 protein sequence
Red=Cloning site Green=Tags(s) MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000249 |
| RefSeq Size | 942 |
| RefSeq ORF | 585 |
| Synonyms | CMH8; MLC-lV/sb; MLC1SB; MLC1V; VLC1; VLCl |
| Locus ID | 4634 |
| Cytogenetics | 3p21.31 |
| Summary | MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400098 | MYL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400098 | Transient overexpression lysate of myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3) |
CNY 3080.00 |
|
| TP303122 | Recombinant protein of human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 20 µg |
CNY 2900.00 |
其它Myosin light chain 3产品
