RAB32 (NM_006834) Human Mass Spec Standard
CAT#: PH303094
RAB32 MS Standard C13 and N15-labeled recombinant protein (NP_006825)
View other "RAB32" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB32 MS Standard C13 and N15-labeled recombinant protein (NP_006825) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203094 |
| Predicted MW | 25 kDa |
| Protein Sequence |
>RC203094 protein sequence
Red=Cloning site Green=Tags(s) MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWD SRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVL LANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK LDQETLRAENKSQCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006825 |
| RefSeq Size | 1234 |
| RefSeq ORF | 675 |
| Locus ID | 10981 |
| Cytogenetics | 6q24.3 |
| Summary | The protein encoded by this gene anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. The encoded protein also appears to be involved in autophagy and melanosome secretion. Variations in this gene may be linked to leprosy. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402044 | RAB32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402044 | Transient overexpression lysate of RAB32, member RAS oncogene family (RAB32) |
CNY 3080.00 |
|
| TP303094 | Recombinant protein of human RAB32, member RAS oncogene family (RAB32), 20 µg |
CNY 2900.00 |
