MED31 (NM_016060) Human Mass Spec Standard
CAT#: PH303047
MED31 MS Standard C13 and N15-labeled recombinant protein (NP_057144)
View other "MED31" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MED31 MS Standard C13 and N15-labeled recombinant protein (NP_057144) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203047 |
Predicted MW | 15.8 kDa |
Protein Sequence |
>RC203047 protein sequence
Red=Cloning site Green=Tags(s) MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057144 |
RefSeq Size | 1656 |
RefSeq ORF | 393 |
Synonyms | 3110004H13Rik; CGI-125; Soh1 |
Locus ID | 51003 |
Cytogenetics | 17p13.1 |
Summary | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414225 | MED31 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414225 | Transient overexpression lysate of mediator complex subunit 31 (MED31) |
CNY 3080.00 |
|
TP303047 | Recombinant protein of human mediator complex subunit 31 (MED31), 20 µg |
CNY 2900.00 |