DERL2 (NM_016041) Human Mass Spec Standard
CAT#: PH303046
DERL2 MS Standard C13 and N15-labeled recombinant protein (NP_057125)
View other "DERL2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DERL2 MS Standard C13 and N15-labeled recombinant protein (NP_057125) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203046 |
| Predicted MW | 27.6 kDa |
| Protein Sequence |
>RC203046 protein sequence
Red=Cloning site Green=Tags(s) MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFN FLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVR MNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFD TPDEDPNYNPLPEERPGGFAWGEGQRLGG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057125 |
| RefSeq Size | 1156 |
| RefSeq ORF | 717 |
| Synonyms | CGI-101; derlin-2; DERtrin-2; F-LAN-1; F-LANa; FLANa |
| Locus ID | 51009 |
| Cytogenetics | 17p13.2 |
| Summary | Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL2 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).[supplied by OMIM, Mar 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402491 | DERL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402491 | Transient overexpression lysate of Der1-like domain family, member 2 (DERL2) |
CNY 3080.00 |
|
| TP303046 | Recombinant protein of human Der1-like domain family, member 2 (DERL2), 20 µg |
CNY 2900.00 |
